PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA3123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 383aa    MW: 43769.5 Da    PI: 6.5492
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA3123genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Tp57577_TGAC_v2_mRNA3123 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                              678*******************************************97 PP

2Myb_DNA-binding46.11.2e-1467110146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               rg ++++E++l+v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Tp57577_TGAC_v2_mRNA3123  67 RGTFSQDEEDLIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                               899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466893.13E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-151461IPR001005SANT/Myb domain
CDDcd001672.45E-111761No hitNo description
PROSITE profilePS5129425.13762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2565116IPR009057Homeodomain-like
SMARTSM007171.1E-1266114IPR001005SANT/Myb domain
PfamPF002493.0E-1367111IPR001005SANT/Myb domain
CDDcd001672.62E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQDEEDLIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPVTHKPLS DIENNGEENS NAKSQEKAAE LLLSSNELNL LKSESSKSDA ASNYEQRTSP  180
KEYALEIEGS CNKDFFIDRF ISTTHHHHHN HNTNSQDLMG NFPIQMSYSN TENDCLPNDS  240
NNHNHNWFNQ TGKTFDMNSN EFHFNSNTTT MFLPNSFDIH SDNVSTEMRS NINLHSNHFS  300
SWGGMMENHT EEANSSNYFH NPILMLASES LCNEIKPSMN LAVDNTFGAI LPNAKQEQEE  360
QLQSSNIFSK DIQKLREAFG DM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469134.10.0myb transcription factor MYB64
TrEMBLA0A072VMV60.0A0A072VMV6_MEDTR; Myb transcription factor MYB64
STRINGGLYMA02G00960.21e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-92myb domain protein 55